Blog

Questions 2–9 refer to this toxic peptide. General Instructions: If the question does not require you to draw a structure, you may answer using either the full name of an amino acid or use its three-letter or single-letter code.   Many animal toxins are peptides. One of these is a 42-residue toxic peptide found in the South American rattlesnake, Crotalus durissus terrifics. The primary sequence of this peptide is shown below and its structure is shown in the figure. YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG Image Description and Attribution A 3D protein structure showing the positions of cysteine residues (Cys4, Cys11, Cys18, Cys30, Cys36, and Cys37) highlighted in yellow. The protein has an N-terminal (N) and C-terminal (C) with distinct secondary structures: alpha-helices in red and beta-sheets in blue, connected by green loops. The cysteine residues form disulfide bonds, contributing to the protein’s stability and shape. Yikrazuul, Structure of Crotamin, Wikimedia Commons, (CC BY-SA 3.0).

According to the Carter & McGoldrick model, a family member with an addiction problem would be considered a vertical stressor.

Three types of time are used to explain a life course perspective.  Which one is not commonly used?

The severity of stress depends, in part, upon the family’s resources and their interpretation of the events surrounding the stressor event.

A stressor is defined as an expected experience in the family life-cycle that causes a minor disturbance.

Sometimes in families with disabled children, the child gets “blamed” for all the marital and family problems.  This violates which of our textbook authors’ characteristics of functional families:

Which statement describes current thinking about models for family life cycles and transactions?

“No two children grow up with the same parents.” Why not?

Healthy families maintain extremely strong external boundaries.

Horizontal stressors move across time and include developmental predictable stresses as well as unpredictable crises and historical events that disrupt the family system.