Blog

Upload an image of your answers to this question. Draw the structure of the N-terminal residue at pH 12.0. (2 pts) Draw the structure of the C-terminal residue at pH 1.0. (2 pts.) Draw the principle structure of residue number 2 at pH 5 showing the absolute stereochemical configuration of the L family of amino acids. (3 pts.)

Pyruvate may also be converted to an amino acid in a single step. Give each of the following: the three-letter code or the name of the amino acid formed in this reaction a generalized enzyme name that describes this reaction type the names or acceptable abbreviations for any necessary cofactors for the reaction

Well-fed State Insulin Questions 1–11 Image Description A diagram illustrating metabolic pathways during the well-fed state, characterized by prevalent insulin levels, with a focus on glycolysis, glycogen synthesis, and the citric acid cycle.Molecule 1: Required and produced in the reaction where glucose (Glc) is phosphorylated to glucose-6-phosphate.Molecule 2: Enzyme catalyzing the conversion of glucose 6-phosphate to glucose 1-phosphate. Molecule 3: Reactant reacting with glucose 1-phosphate, resulting in the production of molecule 4 as a byproduct and molecule 5 as the main product. Molecule 5: Converted into glycogen by enzyme numbered 6, with molecule 7 produced as a byproduct. Molecule 8: Sub-reaction occurring during the conversion of malate into oxaloacetate.Molecule 9: Molecule added to pyruvate when pyruvate is converted to acetyl-CoA, releasing molecule 11, with sub-reaction 10 occurring simultaneously. UTP or UDP or PLP (vitamin B6) ATP/ADP or biotin ATP/AMP or phosphatase or fumarate GTP/GDP or kinase or glutamate NAD+/NADH or dehydrogenase or  α -ketoglutarate NADP+/NADPH or transaminase or carnitine FAD/FADH2 or Mutase or CO2 or HCO3- Pi or 2Pi (phosphate) or synthase or citrate H2O or urea or phosphorylase CoASH or Asp or UDP-Glc

Which of the following is a measure of spread that is not affected by outliers?

These figures show the protein structure of hemocyanin, the copper-containing oxygen transport protein in arthropods, octopuses, and squids. The two figures are of the same protein, one a front view and a back view—a 180o rotation about the vertical axis. The small diamond-shaped dicopper structure is the in the center. This molecule is responsible for the blue color of the oxygenated blood of these animals. Image Description A 3D representation of a protein structure, displaying its complex folding and various regions. The protein features several alpha helices, depicted as spirals, and beta sheets, depicted as arrows, interconnected by loops. The structure is colored with a gradient from blue (N-terminus) to red (C-terminus), illustrating the flow of the polypeptide chain. This visual highlights the intricate architecture crucial for the protein’s specific function. In the three-strand flat ribbon structure, the arrowhead of the middle strand is in the opposite direction from the two other strands. Referring to the figure, briefly describe the secondary structure of the three-strand flat ribbon structure at the top of this protein. (1pt.) The sequence of the vertical helix on the right-hand side of the first figure is IPELEEHLKEI. Briefly explain why this helix has both a polar and a nonpolar side and which way you would expect to find the nonpolar side facing relative to the rest of the protein’s structure. (2 pts.)

Questions 2–9 refer to this toxic peptide. General Instructions: If the question does not require you to draw a structure, you may answer using either the full name of an amino acid or use its three-letter or single-letter code.   Many animal toxins are peptides. One of these is a 42-residue toxic peptide found in the South American rattlesnake, Crotalus durissus terrifics. The primary sequence of this peptide is shown below and its structure is shown in the figure. YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG Image Description and Attribution A 3D protein structure showing the positions of cysteine residues (Cys4, Cys11, Cys18, Cys30, Cys36, and Cys37) highlighted in yellow. The protein has an N-terminal (N) and C-terminal (C) with distinct secondary structures: alpha-helices in red and beta-sheets in blue, connected by green loops. The cysteine residues form disulfide bonds, contributing to the protein’s stability and shape. Yikrazuul, Structure of Crotamin, Wikimedia Commons, (CC BY-SA 3.0).

According to the Carter & McGoldrick model, a family member with an addiction problem would be considered a vertical stressor.

Three types of time are used to explain a life course perspective.  Which one is not commonly used?

The severity of stress depends, in part, upon the family’s resources and their interpretation of the events surrounding the stressor event.

A stressor is defined as an expected experience in the family life-cycle that causes a minor disturbance.