Upload an image of your drawing. The role of lactate (CH3CH(OH)CO2-) in metabolism was evaluated in a review article on lactate metabolism by L. B. Gladden (full citation: Gladden, L. B. (2004). Lactate metabolism: a new paradigm for the third millennium. The Journal of physiology, 558(Pt 1), 5–30). The paragraph below is from the article. La- is lactate. “La- can no longer be considered the usual suspect for metabolic ‘crime’, but is instead a central player in cellular, regional and whole body metabolism. Overall, the cell-to-cell lactate shuttle has expanded far beyond its initial conception as an explanation for muscle and exercise metabolism to now subsume all of the other shuttles as a grand description of the role(s) of La- in numerous metabolic processes and pathways.” One of the proposed metabolic roles of lactate involves a metabolite shuttle between two types of cells within the brain. Glu is the primary excitatory neurotransmitter in the brain. The proposed shuttle system is shown in an illustration from the abovementioned article and depicts, among other things, the recycling of Glu. Image Description This picture depicts a chain of events that occurs in and between a glutaminergic neuron and an astrocyte, two types of cells within the brain. Two different reaction cycles are shown. In the first, La (lactate) begins in the astrocyte. It is able to pass out of the astrocyte and into the glutaminergic neuron. There, in the presence of LDH (lactate dehydrogenase), lactate is converted into Pyr (pyruvate). Here the two reaction cycles intersect with each other. In the presence of AAT (alanine amino transferase), pyruvate is converted into Ala. Simultaneously, this allows Glu in the glutaminergic neuron to be converted into 2-oxoglutamate. The Ala is then able to pass out of the glutaminergic neuron and back into the astrocyte. In the astrocyte, the entire process is reversed. Ala is converted back into pyruvate in the presence of AAT, allowing 2-oxoglutamate in the astrocyte to simultaneously be converted into Glu. Pyruvate is then converted back into lactate in the presence of lactate dehydrogenase. At this point, the cycle repeats. In the second cycle, Glu begins in the glutaminergic neuron. It is able to pass out of the glutaminergic neuron and into the astrocyte. There, in the presence of an unnamed enzyme, NH4- is added to Glu to create Gln. The NH4- was provided by converting the Glu produced in the previous cycle (through conversion of Ala into pyruvate) back into 2-oxoglutamate in the presence of GDH (glutamate dehydrogenase). This creates a new 2-oxoglutamate that can be converted into Glu again the next time the first cycle brings Ala into the astrocyte. Meanwhile, the Gln that was created by the addition of NH4- is able to pass out of the astrocyte and into the glutaminergic neuron. There, the entire process is reversed. Gln is converted back into Glu and a free NH4- in the presence of an unnamed enzyme. This regenerates the Glu in the glutaminergic neuron that began this cycle. Meanwhile, the released NH4- is added back to a 2-oxoglutamate by glutamate dehydrogenase, re-forming the Glu that was transformed into 2-oxoglutamate in the first reaction cycle when pyruvate in the glutaminergic neuron was converted into Ala. The cycle then is able to repeat. La- is lactate, Pyr is pyruvate, AAT is alanine amino transferase, 2-oxoglu (2-oxoglutamate) is another name for a-ketoglutarate, GDH is glutamate dehydrogenase, LDH is lactate dehydrogenase One of the reactions shown in the diagram is the conversion of Glu to Gln. Draw out this reaction. Include the structures of the substrate and product, as well as the key intermediate structure in the reaction, along with any cofactors or co-reactants required for the reaction. (2 pts.) Draw out the reaction that takes 2-oxoglu, which is another name for a-ketoglutarate, directly to Glu (the reaction labeled GDH reaction). You may use names of the substrate and product; structures are not necessary. Include any cofactors and give the enzyme name. (2 pts.)
Blog
We conducted a survey of 300 RIT students and one of the sur…
We conducted a survey of 300 RIT students and one of the survey questions was: “Did you use a ride-service (such as Uber/Lyft) during Fall 2024 semester?” Yes or No We are interested in developing a confidence interval with the survey results. Assume all assumptions have been met. Which statistical feature would we use and why?
A researcher wants to estimate the average high temperature…
A researcher wants to estimate the average high temperature during the month of July in Rochester, NY. Over the past 10 years, the researcher recorded the high temperature for each July and, with the data, the following Minitab output produced: A. Provide a statistical interpretation of the confidence interval written in the context of the problem. [3 points]B. How can we determine if we are able to meet the normality assumption? Explain your reasoning. [2 points]C. What is the point estimate for the confidence interval? [2 points]D. The local newspaper wants to report that with 95% confidence, the true mean July high-temperature in Rochester, NY is at least 80 degrees. Is this reasonable to say with 95% confidence? Explain. [2 points] E. Discuss how the confidence interval formula would change if we, instead, built a 99% confidence interval. Also indicate how this change affects the overall interval. [2 points]
Urea Cycle Questions 32–44 Image Description A diagram of…
Urea Cycle Questions 32–44 Image Description A diagram of the urea cycle, a critical metabolic pathway in the liver responsible for converting ammonia to urea, which is then excreted from the body. The diagram includes several numbered labels corresponding to various molecules, enzymes, and steps in the urea cycle. Let’s go through the numbers and their associated components in the urea cycle. Molecule 32 is produced by molecule 34 in the presence of the cofactor molecule 33. This reaction occurs simultaneously with the reaction of oxaloacetate into molecule 39. Molecule 33 refers to a cofactor necessary for the reaction that converts molecule 34 to 32. Molecule 34 is the product of glutamine reacting with molecule 36 and releasing a free ammonium. Molecule 35 is required and produced in the reaction where molecule 34 is converted into alpha-ketoglutarate. Molecule 36 is required for the conversion of glutamine into molecule 34 and a free ammonium. Molecule 37 is required and produced in the process of converting HCO3- into CO2-phosphate. Molecule 38 is required and produced in the process of converting amino-CO2 into carbamoyl phosphate (amino-CO2-phosphate). Molecule 39 is the product of a reaction involving oxaloacetate, in which molecule 34 is converted into molecule 32 in the presence of the cofactor molecule 33. Molecule 39 transfers from the matrix into the cytosol as molecule 41. Molecule 40 is required and produced in the process of citrulline being combined with molecule 41 to produce argininosuccinate. UTP or UDP or PLP (vitamin B6) ATP/ADP or biotin ATP/AMP or phosphatase or fumarate GTP/GDP or kinase or glutamate NAD+/NADH or dehydrogenase or α -ketoglutarate NADP+/NADPH or transaminase or carnitine FAD/FADH2 or mutase or CO2 or HCO3- Pi or 2Pi (phosphate) or synthase or citrate H2O or urea or phosphorylase CoASH or Asp or UDP-Glc
Upload an image of your answers to this question. Draw the…
Upload an image of your answers to this question. Draw the structure of the N-terminal residue at pH 12.0. (2 pts) Draw the structure of the C-terminal residue at pH 1.0. (2 pts.) Draw the principle structure of residue number 2 at pH 5 showing the absolute stereochemical configuration of the L family of amino acids. (3 pts.)
Pyruvate may also be converted to an amino acid in a single…
Pyruvate may also be converted to an amino acid in a single step. Give each of the following: the three-letter code or the name of the amino acid formed in this reaction a generalized enzyme name that describes this reaction type the names or acceptable abbreviations for any necessary cofactors for the reaction
Well-fed State Insulin Questions 1–11 Image Description A…
Well-fed State Insulin Questions 1–11 Image Description A diagram illustrating metabolic pathways during the well-fed state, characterized by prevalent insulin levels, with a focus on glycolysis, glycogen synthesis, and the citric acid cycle.Molecule 1: Required and produced in the reaction where glucose (Glc) is phosphorylated to glucose-6-phosphate.Molecule 2: Enzyme catalyzing the conversion of glucose 6-phosphate to glucose 1-phosphate. Molecule 3: Reactant reacting with glucose 1-phosphate, resulting in the production of molecule 4 as a byproduct and molecule 5 as the main product. Molecule 5: Converted into glycogen by enzyme numbered 6, with molecule 7 produced as a byproduct. Molecule 8: Sub-reaction occurring during the conversion of malate into oxaloacetate.Molecule 9: Molecule added to pyruvate when pyruvate is converted to acetyl-CoA, releasing molecule 11, with sub-reaction 10 occurring simultaneously. UTP or UDP or PLP (vitamin B6) ATP/ADP or biotin ATP/AMP or phosphatase or fumarate GTP/GDP or kinase or glutamate NAD+/NADH or dehydrogenase or α -ketoglutarate NADP+/NADPH or transaminase or carnitine FAD/FADH2 or Mutase or CO2 or HCO3- Pi or 2Pi (phosphate) or synthase or citrate H2O or urea or phosphorylase CoASH or Asp or UDP-Glc
Which of the following is a measure of spread that is not af…
Which of the following is a measure of spread that is not affected by outliers?
These figures show the protein structure of hemocyanin, the…
These figures show the protein structure of hemocyanin, the copper-containing oxygen transport protein in arthropods, octopuses, and squids. The two figures are of the same protein, one a front view and a back view—a 180o rotation about the vertical axis. The small diamond-shaped dicopper structure is the in the center. This molecule is responsible for the blue color of the oxygenated blood of these animals. Image Description A 3D representation of a protein structure, displaying its complex folding and various regions. The protein features several alpha helices, depicted as spirals, and beta sheets, depicted as arrows, interconnected by loops. The structure is colored with a gradient from blue (N-terminus) to red (C-terminus), illustrating the flow of the polypeptide chain. This visual highlights the intricate architecture crucial for the protein’s specific function. In the three-strand flat ribbon structure, the arrowhead of the middle strand is in the opposite direction from the two other strands. Referring to the figure, briefly describe the secondary structure of the three-strand flat ribbon structure at the top of this protein. (1pt.) The sequence of the vertical helix on the right-hand side of the first figure is IPELEEHLKEI. Briefly explain why this helix has both a polar and a nonpolar side and which way you would expect to find the nonpolar side facing relative to the rest of the protein’s structure. (2 pts.)
Questions 2–9 refer to this toxic peptide. General Instructi…
Questions 2–9 refer to this toxic peptide. General Instructions: If the question does not require you to draw a structure, you may answer using either the full name of an amino acid or use its three-letter or single-letter code. Many animal toxins are peptides. One of these is a 42-residue toxic peptide found in the South American rattlesnake, Crotalus durissus terrifics. The primary sequence of this peptide is shown below and its structure is shown in the figure. YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG Image Description and Attribution A 3D protein structure showing the positions of cysteine residues (Cys4, Cys11, Cys18, Cys30, Cys36, and Cys37) highlighted in yellow. The protein has an N-terminal (N) and C-terminal (C) with distinct secondary structures: alpha-helices in red and beta-sheets in blue, connected by green loops. The cysteine residues form disulfide bonds, contributing to the protein’s stability and shape. Yikrazuul, Structure of Crotamin, Wikimedia Commons, (CC BY-SA 3.0).